Neuropeptide Database

Total number of results for Canis familiaris are 63

NPID	Sequence	Length	Organism	Family	Name	Peptide_REF
NP00023	SQAEFDKAAEDVKHLKTKPADDEMLYIYSHYKQATVGDINTERPGLLDLRGKAKWDAWNQLKGTSKEDAMKAYVNKVEDLKKKYGI	86	Canis familiaris	ACBP	Acyl-CoA-binding protein	8609609#Kragelund B.B., Hoejrup P., Jensen M.S., Schjerling C.K., Juul E., Knudsen J., Poulsen F.M.#Fast and one-step folding of closely and distantly related homologous proteins of a four-helix bundle family.# J. Mol. Biol. 256:187-200(1996).
NP00821	SCNTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSEAF	37	Canis familiaris	Calcitonin	Calcitonin gene-related peptide 1
NP00822	CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP	32	Canis familiaris	Calcitonin	Calcitonin
NP00823	SCNSATCVAHWLGGLLSRAGSVANTNLLPTSMGFKVYNRRRRELKA	46	Canis familiaris	Calcitonin	Calcitonin receptor-stimulating peptide 1
NP00824	SCKDGPCVTNRLEGWLARAERMVKNTFMPTDVDPEAFGHQHKELAA	46	Canis familiaris	Calcitonin	Calcitonin receptor-stimulating peptide 2
NP00825	CNTATCATQRLANFLVRTSNNLGAILSPTNVGSNTY	36	Canis familiaris	Calcitonin	Islet amyloid polypeptide
NP01118	CSCSSLMDKECVYFCHLDIIW	21	Canis familiaris	Endothelin/sarafotoxin	Endothelin-1
NP01119	CSCSSWLDKECVYFCHLDIIW	21	Canis familiaris	Endothelin/sarafotoxin	Endothelin-2
NP01120	CTCFTYKDKECVYYCHLDIIW	21	Canis familiaris	Endothelin/sarafotoxin	Endothelin-3
NP02162	AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF	58	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-58	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).$7134033#Eysselein V.E., Reeve J.R. Jr., Shively J.E., Hawke D., Walsh J.H.#Partial structure of a large canine cholecystokinin (CCK58): amino acid sequence.#Peptides 3:687-691(1982).$12686463#Reeve J.R. Jr., Keire D.A., Coskun T., Green G.M., Evans C., Ho F.-J., Lee T.D., Davis M.T., Shively J.E., Solomon T.E.#Synthesis of biologically active canine CCK-58.#Regul. Pept. 113:71-77(2003).$15064233#Reeve J.R. Jr., Liddle R.A., McVey D.C., Vigna S.R., Solomon T.E., Keire D.A., Rosenquist G., Shively J.E., Lee T.D., Chew P., Green G.M., Coskun T.#Identification of nonsulfated cholecystokinin-58 in canine intestinal extracts and its biological properties.#Am. J. Physiol. 287:G326-G333(2004).$6093106#Eysselein V.E., Reeve J.R. Jr., Shively J.E., Miller C., Walsh J.H.#Isolation of a large cholecystokinin precursor from canine brain.#Proc. Natl. Acad. Sci. U.S.A. 81:6565-6568(1984).$1713209#Reeve J.R. Jr., Eysselein V.E., Eberlein G.A., Chew P., Ho F.-J., Huebner V.D., Shively J.E., Lee T.D., Liddle R.A.#Characterization of canine intestinal cholecystokinin-58 lacking its carboxyl-terminal nonapeptide. Evidence for similar post-translational processing in brain and gut.#J. Biol. Chem. 266:13770-13776(1991).
NP02163	AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQNLDPSHRISD	49	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-58 desnonopeptide	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).$7134033#Eysselein V.E., Reeve J.R. Jr., Shively J.E., Hawke D., Walsh J.H.#Partial structure of a large canine cholecystokinin (CCK58): amino acid sequence.#Peptides 3:687-691(1982).$12686463#Reeve J.R. Jr., Keire D.A., Coskun T., Green G.M., Evans C., Ho F.-J., Lee T.D., Davis M.T., Shively J.E., Solomon T.E.#Synthesis of biologically active canine CCK-58.#Regul. Pept. 113:71-77(2003).$15064233#Reeve J.R. Jr., Liddle R.A., McVey D.C., Vigna S.R., Solomon T.E., Keire D.A., Rosenquist G., Shively J.E., Lee T.D., Chew P., Green G.M., Coskun T.#Identification of nonsulfated cholecystokinin-58 in canine intestinal extracts and its biological properties.#Am. J. Physiol. 287:G326-G333(2004).$6093106#Eysselein V.E., Reeve J.R. Jr., Shively J.E., Miller C., Walsh J.H.#Isolation of a large cholecystokinin precursor from canine brain.#Proc. Natl. Acad. Sci. U.S.A. 81:6565-6568(1984).$1713209#Reeve J.R. Jr., Eysselein V.E., Eberlein G.A., Chew P., Ho F.-J., Huebner V.D., Shively J.E., Lee T.D., Liddle R.A.#Characterization of canine intestinal cholecystokinin-58 lacking its carboxyl-terminal nonapeptide. Evidence for similar post-translational processing in brain and gut.#J. Biol. Chem. 266:13770-13776(1991).
NP02164	YIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF	39	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-39	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).
NP02165	KAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF	33	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-33	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).
NP02166	VIKNLQNLDPSHRISDRDYMGWMDF	25	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-25	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).
NP02167	LDPSHRISDRDYMGWMDF	18	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-18	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).
NP02168	ISDRDYMGWMDF	12	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-12 (By similarity)	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).
NP02169	DYMGWMDF	8	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-8	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).
NP02170	YMGWMDF	7	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-7	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).
NP02171	GWMDF	5	Canis familiaris	Gastrin/cholecystokinin	Cholecystokinin-5	2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).
NP02172	QLGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDF	34	Canis familiaris	Gastrin/cholecystokinin	Big gastrin	3763441#Bonato C., Eng J., Hulmes J.D., Miedel M., Pan Y.-C.E., Yalow R.S.#Sequences of gastrins purified from a single antrum of dog and of goat.# Peptides 7:689-693(1986).$5799207#Agarwal K.L., Kenner G.W., Sheppard R.C.#Structure and synthesis of canine gastrin.#Experientia 25:346-348(1969).
NP02173	QGPWMEEEEAAYGWMDF	17	Canis familiaris	Gastrin/cholecystokinin	Gastrin	5799207#Agarwal K.L., Kenner G.W., Sheppard R.C.#Structure and synthesis of canine gastrin.#Experientia 25:346-348(1969).
NP02284	HSDGTFTSELSRLRESARLQRLLQGLV	27	Canis familiaris	Glucagon	Secretin	3626755#Shinomura Y, Eng J, Yalow RS#Dog secretin: sequence and biologic activity#Life Sci 1987 Sep 7;41(10):1243-8
NP02296	RSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	69	Canis familiaris	Glucagon	Glicentin	3238052#Shinomura Y., Eng J., Yalow R.S.#Immunoreactive glucagons purified from dog pancreas, stomach and ileum.# Regul. Pept. 23:299-308(1988).
NP02297	RSLQDTEEKSRSFSAPQTEPLNDLDQMNED	30	Canis familiaris	Glucagon	Glicentin-related polypeptide (By similarity)
NP02298	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	37	Canis familiaris	Glucagon	Oxyntomodulin (By similarity)
NP02299	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Canis familiaris	Glucagon	Glucagon (By similarity)
NP02300	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Canis familiaris	Glucagon	Glucagon-like peptide 1
NP02301	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Canis familiaris	Glucagon	Glucagon-like peptide 1(7-37)
NP02302	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Canis familiaris	Glucagon	Glucagon-like peptide 1(7-36)
NP02303	HADGSFSDEMNTVLDTLATRDFINWLLQTKITD	33	Canis familiaris	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02304	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Canis familiaris	Glucagon	Vasoactive intestinal peptide	3748846#Eng J., Du B.-H., Raufman J.-P., Yalow R.S.#Purification and amino acid sequences of dog, goat and guinea pig VIPs.# Peptides 7 Suppl. 1:17-20(1986).
NP02625	GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA	70	Canis familiaris	Insulin	Insulin-like growth factor I
NP02626	FVNQHLCGSHLVEALYLVCGERGFFYTPKA	30	Canis familiaris	Insulin	Insulin B chain	5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966).
NP02627	GIVEQCCTSICSLYQLENYCN	21	Canis familiaris	Insulin	Insulin A chain	5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966).
NP02628	TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRE	35	Canis familiaris	Insulin	Relaxin B chain	1388669#Stewart D.R., Henzel W.J., Vandlen R.#Purification and sequence determination of canine relaxin.# J. Protein Chem. 11:247-253(1992).
NP02629	DNYIKMSDKCCNVGCTRRELASRC	24	Canis familiaris	Insulin	Relaxin A chain	1388669#Stewart D.R., Henzel W.J., Vandlen R.#Purification and sequence determination of canine relaxin.# J. Protein Chem. 11:247-253(1992).
NP02855	VPIRKVQDDTKTLIKTIVARINDISHTQSVSSKQRVAGLDFIPGLQPVLSLSRMDQTLAIYQQILNSLHSRNVVQISNDLENLRDLLHLLASSKSCPLPRARGLETFESLGGVLEASLYSTEVVALNRLQAALQDMLRRLDLSPGC	146	Canis familiaris	Leptin	Leptin
NP02904	ILLSASKSIRNLEDDMVFNTFRLGKALQKEDTPQKSVVAPSLEQYKNDDSSFMNDEENKNSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV	144	Canis familiaris	Melanin-concentrating hormone	Pro-MCH
NP02905	DFDMLRCMLGRVYRPCWQV	19	Canis familiaris	Melanin-concentrating hormone	Melanin-concentrating hormone
NP02906	EIGDEENSAKFPI	13	Canis familiaris	Melanin-concentrating hormone	Neuropeptide-glutamic acid-isoleucine
NP02907	GSVAFPAENGVQNTESTQE	19	Canis familiaris	Melanin-concentrating hormone	Neuropeptide-glycine-glutamic acid(Potential)
NP02989	FVPIFTHSELQKIREKERNKGQ	22	Canis familiaris	Motilin	Motilin	6844663#Poitras P., Reeve J.R. Jr., Hunkapiller M.W., Hood L.E., Walsh J.H.; #Purification and characterization of canine intestinal motilin.; #Regul. Pept. 5:197-208(1983).
NP03628	HPLGGRSPASEASEASEASGLWAVQELLGRLKDAVSELQAEQLALEPLHRSHSPAEAPEAGGTPRGVLAPHDSVLQALRRLRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY	114	Canis familiaris	Natriuretic peptide	Natriuretic peptides B
NP03629	LRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY	34	Canis familiaris	Natriuretic peptide	Brain natriuretic peptide 34
NP03630	MMHKSGCFGRRLDRIGSLSGLGCNVLRKY	29	Canis familiaris	Natriuretic peptide	Brain natriuretic peptide 29
NP03631	SLRRSSCFGGRMDRIGAQSGLGCNSFRY	28	Canis familiaris	Natriuretic peptide	Atrial natriuretic factor
NP03727	EFLFRPRN	8	Canis familiaris	Neuromedins	Neuromedin U-8	10959581#Sakura N, Kurosawa K, Hashimoto T#Structure-activity relationships of neuromedin U#IV Absolute requirement of the arginine residue at position 7 of dog neuromedin U-8 for contractile activity Chem Pharm Bull (Tokyo) 2000 Aug;48(8):1166-70
NP03728	EXLXRPRN	8	Canis familiaris	Neuromedins	Neuromedin U-8	8904815#Kurosawa K, Sakura N, Hashimoto T#Structure-activity relationships of neuromedin U#III Contribution of two phenylalanine residues in dog neuromedin U-8 to the contractile activity Chem Pharm Bull (Tokyo) 1996 Oct;44(10):1880-4
NP03738	FRLDEEFQGPIASQVRRQFLFRPRN	25	Canis familiaris	Neuromedins	Neuromedin-U-25	2052487#O'Harte F, Bockman CS, Abel PW, Conlon JM#Isolation, structural characterization and pharmacological activity of dog neuromedin U#Peptides 1991 Jan-Feb;12(1):11-5
NP03773	SDSEEEMKALEADLLTNMHTSKISKASVSSWKMTLLNVCSFVNNLNSQAEETGEFREEELITRRKFPTALDGFSLEAMLTIYQLQKICHSRAFQQWELIQEDVLDAGNDKNEKEEVIKRKIPYIL	125	Canis familiaris	Neurotensin	Large neuromedin N
NP03774	KIPYIL	6	Canis familiaris	Neurotensin	Neuromedin N	2341398#Carraway R.E., Mitra S.P.#Differential processing of neurotensin/neuromedin N precursor(s) in canine brain and intestine.# J. Biol. Chem. 265:8627-8631(1990).
NP03775	QLYENKPRRPYILKRGSYYY	20	Canis familiaris	Neurotensin	NT-tail	1494486#Carraway R.E., Mitra S.P., Salmonsen R.#Isolation and quantitation of several new peptides from the canine neurotensin/neuromedin N precursor.#Peptides 13:1039-1047(1992).
NP03776	QLYENKPRRPYIL	13	Canis familiaris	Neurotensin	Neurotensin	1494486#Carraway R.E., Mitra S.P., Salmonsen R.#Isolation and quantitation of several new peptides from the canine neurotensin/neuromedin N precursor.#Peptides 13:1039-1047(1992).
NP03777	GSYYY	5	Canis familiaris	Neurotensin	Tail peptide (Potential)
NP03935	APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY	36	Canis familiaris	NPY	Pancreatic hormone	#Chance R.E., Moon N.E., Johnson M.G.## (In) Jaffe B.M., Behrman H.R. (eds.); Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, Academic Press, New York and London (1979).
NP03936	DRGEMRDILEWGSPHAAAPR	20	Canis familiaris	NPY	Pancreatic icosapeptide	7031480#Schwartz T.W., Tager H.S.#Isolation and biogenesis of a new peptide from pancreatic islets.#Nature 294:589-591(1981).
NP04398	QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTL	33	Canis familiaris	Orexin	Orexin-A
NP04399	RPGPPGLQGRLQRLLQASGNHAAGILTM	28	Canis familiaris	Orexin	Orexin-B
NP04412	AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLNSGVAESGLEGDHPYDISATSLELNLRRH	141	Canis familiaris	Parathyroid hormone	Parathyroid hormone-related protein
NP04413	TRSAWLNSGVAESGLEGDHPYDISATSLELNLR	33	Canis familiaris	Parathyroid hormone	Osteostatin (By similarity)
NP05232	SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII	41	Canis familiaris	Sauvagine/corticotropin-releasing factor/urotensin I	Corticoliberin
NP05385	SANSNPAMAPRERKAGCKNFFWKTFTSC	28	Canis familiaris	Somastostatin	Somatostatin-28
NP05386	AGCKNFFWKTFTSC	14	Canis familiaris	Somastostatin	Somatostatin-14